Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDPSAKRQRLDSTGRFSPASPPFDVAALASTTTKTPIHPRTPTSPPYSSMNSQHNGGFAQGSTAAPSLTSPHAALPMSHSLSQSATSASTLPPFPTPASTTGVMSSANIDSDGDAMMEDSTDDDASRIDTHRQTNHNRQRNPIYTPDGRIKAAQGICGNRLFKLNEGKVEPSRPHCSQNLLKLYGLEPLARSVARNDPITGEKINKLRKSYEGHIKQMQIAGKPKATKMDRVFLDPLSMGWEDWQNTKVQGKEIAKTGLNHDQTALAPDFASKLDAALAGMSPGPLPNADAAKYRAYIGTDDTVKTKPQDAPPQRPFTSSAPTPTNGAQQQRGPHRPERTGSKRQYTDAAFQGYGEGYGDADSTGGEDNAQGSMSKRRKLFERTSHSVEVGGARR |
Length | 396 |
Position | Head |
Organism | Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Leptosphaeriaceae> Leptosphaeria> Leptosphaeria maculans species complex. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.877 |
Instability index | 47.85 |
Isoelectric point | 9.41 |
Molecular weight | 42594.73 |
Publications | PubMed=21326234 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26672 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 140.62| 42| 44| 4| 47| 1 --------------------------------------------------------------------------- 4- 28 (22.75/ 9.60) ......................PSAKRQRLDSTGRFSPASP....PFdvAA 29- 75 (66.61/29.43) LAST..TTKTPIHPRTPTSPPySSMNSQHNGGFAQGSTAAPsltsPH..AA 298- 338 (51.26/20.44) YIGTddTVKTKPQDAPPQRPFtSSAPTPTNGAQQQRGPHRP.......... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 133.73| 44| 47| 160| 205| 2 --------------------------------------------------------------------------- 160- 205 (66.93/57.34) NRLFKLNEGKVE....PSRPHCSQnLLKLYgLEPLARSVA..RNDPITGEKI 206- 255 (66.79/46.67) NKLRKSYEGHIKqmqiAGKPKATK.MDRVF.LDPLSMGWEdwQNTKVQGKEI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAKYRAYIGTDDTVK 2) AKRQRLD 3) SMSKRRKLFERTSHSVEVGGAR 4) YGEGY | 292 6 374 355 | 306 12 395 359 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab