Description | RNA polymerase II transcription subunit 21 mediator |
Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSPAIPPSNVPTAIPQLKKIPKNAPPNAPAAQPASGQAQGQDQKGQTPQQQQQQGGDAAGGAQEQNRDLPPRPDSPNTFAQRQRELARDLIIKEQQIEYLISVLPGIGSSEAEQEARIRQLADELREAEKIRKRKRKQMKKLAEKVDGLLEAVSRGI |
Length | 188 |
Position | Middle |
Organism | Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Nannizzia. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.804 |
Instability index | 58.01 |
Isoelectric point | 8.53 |
Molecular weight | 20752.19 |
Publications | PubMed=22951933 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP26659 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 93.79| 22| 33| 100| 121| 1 --------------------------------------------------------------------------- 75- 89 (20.00/ 6.97) ...KGQTP....QQQQQQGGDA 100- 121 (39.45/19.93) LPPRPDSPNTFAQRQRELARDL 135- 156 (34.34/16.52) LPGIGSSEAEQEARIRQLADEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPQLKKIPK 2) RKRKRK | 45 163 | 53 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab