<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26659
| Description |
RNA polymerase II transcription subunit 21 mediator |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSPAIPPSNVPTAIPQLKKIPKNAPPNAPAAQPASGQAQGQDQKGQTPQQQQQQGGDAAGGAQEQNRDLPPRPDSPNTFAQRQRELARDLIIKEQQIEYLISVLPGIGSSEAEQEARIRQLADELREAEKIRKRKRKQMKKLAEKVDGLLEAVSRGI |
| Length | 188 |
| Position | Middle |
| Organism | Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Arthrodermataceae> Nannizzia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.804 |
| Instability index | 58.01 |
| Isoelectric point | 8.53 |
| Molecular weight | 20752.19 |
| Publications | PubMed=22951933
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.79| 22| 33| 100| 121| 1
---------------------------------------------------------------------------
75- 89 (20.00/ 6.97) ...KGQTP....QQQQQQGGDA
100- 121 (39.45/19.93) LPPRPDSPNTFAQRQRELARDL
135- 156 (34.34/16.52) LPGIGSSEAEQEARIRQLADEL
---------------------------------------------------------------------------
|