| Description | RNA polymerase II transcription subunit 21 mediator |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHSPAIPPSNVPTAIPQLKKIPKNAPPNAPAAQPASGQAQGQDQKGQTPQQQQQQGGDAAGGAQEQNRDLPPRPDSPNTFAQRQRELARDLIIKEQQIEYLISVLPGIGSSEAEQEARIRQLADELREAEKIRKRKRKQMKKLAEKVDGLLEAVSRGI |
| Length | 188 |
| Position | Middle |
| Organism | Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) (Microsporum gypseum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Arthrodermataceae> Nannizzia. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.804 |
| Instability index | 58.01 |
| Isoelectric point | 8.53 |
| Molecular weight | 20752.19 |
| Publications | PubMed=22951933 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP26659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.79| 22| 33| 100| 121| 1
---------------------------------------------------------------------------
75- 89 (20.00/ 6.97) ...KGQTP....QQQQQQGGDA
100- 121 (39.45/19.93) LPPRPDSPNTFAQRQRELARDL
135- 156 (34.34/16.52) LPGIGSSEAEQEARIRQLADEL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IPQLKKIPK 2) RKRKRK | 45 163 | 53 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab