| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAEKFDNLEEHLEKFIENIRQLGIIVSDFQPSSQTGLNQKLNLMITGLQDIEKCRQQLNDIHVPLEAFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMTKFKSLLISELGKVFPEEMAKYKAIHGDDPPS |
| Length | 134 |
| Position | Middle |
| Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes> Ictaluridae> Ictalurus. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.566 |
| Instability index | 47.28 |
| Isoelectric point | 5.24 |
| Molecular weight | 15407.48 |
| Publications | PubMed=20634964 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | atrioventricular canal development GO:0036302 IEA:Ensembl cardiac jelly development GO:1905072 IEA:Ensembl regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP26655 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ERALAK 2) MAKYKAIHG | 86 121 | 91 129 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab