| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MPPPIAPPDEQEFDQPQIIAGLLHPDLHAGNNVFWYFTSSPWFEAECLNINVWLNVRQNDPATAEQIMNDRKLWQQRLDDQPIGTQYVLAGEGQGEGHPWLLQRQNKVSVVKDDKEQIETFVEGNYYTHGTKMLMAPSLLDIIQSRLLTVSTRMQQMAELSKNMTHWTPATGYSYFPPSYEAAKAATTASRVGSPTLAPTDLDGAVPQSQSAGAAAATATTTTTTQTTEPTASGTEFSDMLFLQSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVSARNKAQEQAAQATQQLPPAAALKIDTQTASALPSAAPTPKGGATPGAAPGTPGSKGSVGPAPKKKKDRRKSQGGLTSPTTPSVPQ |
| Length | 364 |
| Position | Head |
| Organism | Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Pyrenophora. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.540 |
| Instability index | 49.16 |
| Isoelectric point | 5.23 |
| Molecular weight | 39013.09 |
| Publications | PubMed=21067574 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP26647
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.49| 20| 29| 309| 331| 1
---------------------------------------------------------------------------
312- 331 (41.92/20.96) PSAAPTPK.........GGATPGAAPGTP
335- 363 (27.57/ 6.53) GSVGPAPKkkkdrrksqGGLTSPTTPSVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.50| 24| 29| 177| 200| 2
---------------------------------------------------------------------------
177- 200 (42.54/23.31) PPSYEAAKAA.....TTASRVGSPTLAPT
207- 235 (35.97/18.54) PQSQSAGAAAatattTTTTQTTEPTASGT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.82| 12| 29| 266| 277| 6
---------------------------------------------------------------------------
266- 277 (21.77/12.54) PGAFVFEGTKTA
297- 308 (20.04/11.05) PAAALKIDTQTA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AAPGTPGSKGSVGPAPKKKKDRRKSQGGL 2) LKIDTQT | 326 301 | 354 307 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab