Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPPPIAPPDEQEFDQPQIIAGLLHPDLHAGNNVFWYFTSSPWFEAECLNINVWLNVRQNDPATAEQIMNDRKLWQQRLDDQPIGTQYVLAGEGQGEGHPWLLQRQNKVSVVKDDKEQIETFVEGNYYTHGTKMLMAPSLLDIIQSRLLTVSTRMQQMAELSKNMTHWTPATGYSYFPPSYEAAKAATTASRVGSPTLAPTDLDGAVPQSQSAGAAAATATTTTTTQTTEPTASGTEFSDMLFLQSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVSARNKAQEQAAQATQQLPPAAALKIDTQTASALPSAAPTPKGGATPGAAPGTPGSKGSVGPAPKKKKDRRKSQGGLTSPTTPSVPQ |
Length | 364 |
Position | Head |
Organism | Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Pyrenophora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.540 |
Instability index | 49.16 |
Isoelectric point | 5.23 |
Molecular weight | 39013.09 |
Publications | PubMed=21067574 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26647 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.49| 20| 29| 309| 331| 1 --------------------------------------------------------------------------- 312- 331 (41.92/20.96) PSAAPTPK.........GGATPGAAPGTP 335- 363 (27.57/ 6.53) GSVGPAPKkkkdrrksqGGLTSPTTPSVP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.50| 24| 29| 177| 200| 2 --------------------------------------------------------------------------- 177- 200 (42.54/23.31) PPSYEAAKAA.....TTASRVGSPTLAPT 207- 235 (35.97/18.54) PQSQSAGAAAatattTTTTQTTEPTASGT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.82| 12| 29| 266| 277| 6 --------------------------------------------------------------------------- 266- 277 (21.77/12.54) PGAFVFEGTKTA 297- 308 (20.04/11.05) PAAALKIDTQTA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAPGTPGSKGSVGPAPKKKKDRRKSQGGL 2) LKIDTQT | 326 301 | 354 307 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab