Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MTTESRQQSSIAETWRRVSSAPSPRINIKNHQTSQNGKLLASAWPLAIVTVEAQLKDIVQNLYNLIVQAYDHHGSKTQDAMKREIQVLVQNLVQLSRTAPSIQINIPPEVMSYVENSRNPDIFTREFVETVQRMNQMLNGRVDAYRMLQEQLARQVSSAIPELKDDVSSLVETTGGRVTV |
Length | 180 |
Position | Middle |
Organism | Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Pyrenophora. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.416 |
Instability index | 43.92 |
Isoelectric point | 8.05 |
Molecular weight | 20329.84 |
Publications | PubMed=21067574 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26641 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 217.99| 69| 80| 21| 90| 1 --------------------------------------------------------------------------- 21- 90 (109.86/63.89) APSPRINIKNH.....QTSQNGKLLASAWPLAIVTVEAQLKDIVQNlYNLIVQAYDHHGSKTQDAMKREIQVLVQ 99- 172 (108.13/59.31) APSIQINIPPEvmsyvENSRNPDIFTREFVETVQRMNQMLNGRVDA.YRMLQEQLARQVSSAIPELKDDVSSLVE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IAETWRR 2) PRINIK | 11 24 | 17 29 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab