<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26629
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYELFLTTLVDDDDIQAACSVLGGLCAMPAWQSLHRVLYFKGPAKPGGISKQNSIPKTPRKDIQMLWKDLHQQLSRQSYILQARYEVFKDKDFGPTAPEVDFNARPGTLRWTDFPDPPQNRSSVTQRKKTEIWDQKDLMSVMRDNNYQFKSEAVEETYQFFREDVEFCLSRHYILQMNGDNGPLTHTGPWETMSPADPGRRWMFLIKVHVHQDNKPDEILKAHEQLASIRRELEGVFDFKMFDRRIHDTRVAVEVRNAPAPLPQVMTVTDQR |
| Length | 272 |
| Position | Head |
| Organism | Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus) (Glomerella graminicola) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum graminicola species complex.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.672 |
| Instability index | 54.63 |
| Isoelectric point | 6.46 |
| Molecular weight | 31698.67 |
| Publications | PubMed=22885923
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26629
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 180.15| 56| 89| 92| 150| 1
---------------------------------------------------------------------------
92- 143 (76.45/51.36) ....................................DFGP...TAP.EVDFNARPGTLRWTdFPdpPQNRSSVTQ.RKKTEIWDQKD.LMSVMR
144- 231 (63.30/33.25) DNNYQFKseaveetyqffredvefclsrhyilqmngDNGPlthTGPwETMSPADPGR.RWM.FL....IKVHVHQdNKPDEILKAHEqLASIRR
234- 272 (40.40/18.96) EGVFDFK.........................mfdrRIHD...TRV.AVEVRNAPAPL........PQVMTVTDQ.R.................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.72| 18| 92| 64| 82| 2
---------------------------------------------------------------------------
64- 82 (30.62/26.95) QMLWKDLHQQLSRQsYILQ
159- 176 (35.10/25.52) QFFREDVEFCLSRH.YILQ
---------------------------------------------------------------------------
|