<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26614
Description |
Uncharacterized protein |
Sequence | MDTSRDSSNLLDTHNRLIADVLSRFRMLTMLATIQAEGERKNAEPQTVAVTGISMQIEFEGLHTSIKDLLALSRRLKELWLFGKLGRGEGDARIQADKLQADVVRCAELLNAIQEKRYAGLASAAGGKWAPMGRPDAAAPVEGAAATAPPPANTAASNGSGGGNGAGAA |
Length | 169 |
Position | Head |
Organism | Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) (Maize anthracnose fungus) (Glomerella graminicola) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum graminicola species complex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.224 |
Instability index | 28.03 |
Isoelectric point | 6.74 |
Molecular weight | 17666.81 |
Publications | PubMed=22885923
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26614
No repeats found
|