<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26608
| Description |
CRE-CIC-1 protein |
| Sequence | MAMNFWKSSHAQQWMFDKTEIWKQRAEDMKTYSEDEYNRLNIFWANFITAVATECAHSQANVGCKLRQQVIATAIVYFKRFYLRQSFRDMCPFLVASTALFLACKVEEHTTLSVSSFLKNTALVLPKRWGVTFETTSAKNGVLYDSEFILVEILDCCLVVYHPQRPMVELLDDFRLYTNSSASPTSPLKDFESIEAQCQKVINDTLRCDVGLIYAPHIIAISSILVAMDLMGRGEELEGWMVEVDVDMEKVADCTDQIYKMYTLWRSFDEKEEVKKLMAKLPKPNQQQMTQQQQHHHHHQQQSSSGYHM |
| Length | 309 |
| Position | Kinase |
| Organism | Caenorhabditis remanei (Caenorhabditis vulgaris) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.271 |
| Instability index | 55.94 |
| Isoelectric point | 5.89 |
| Molecular weight | 35856.76 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26608
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.35| 14| 14| 142| 155| 2
---------------------------------------------------------------------------
142- 155 (23.64/17.94) VLYDSEFILVEILD
159- 172 (26.71/21.18) VVYHPQRPMVELLD
---------------------------------------------------------------------------
|