Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MDNVVDVDEEISQQKLSVNSTPYQTQECVLYGSIYIKNVPDLERRLAGLCDPGCEEFFEHEMSFSLRTASTYDLKTDIKLRRRFRSDNQVQNYWQLKYIGVPEPDQKCPTIVRKEISSLVHSNDMMTYAKSLGLRMDYEYITQGKLWTKGNIKILHATLTKTLKAGTYDSTSIKSMSDSALVEISISLPESAEYMTAAKTLRDFADQLMPLVHMEKVDYWKKIFSTPTAPAARR |
Length | 234 |
Position | Head |
Organism | Caenorhabditis remanei (Caenorhabditis vulgaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.458 |
Instability index | 45.84 |
Isoelectric point | 6.44 |
Molecular weight | 26848.40 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26606 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.57| 18| 67| 115| 132| 1 --------------------------------------------------------------------------- 115- 132 (33.61/23.45) EIS.SLVHSNDMMTYAKSL 183- 201 (27.97/18.47) EISiSLPESAEYMTAAKTL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) YWKKIF 2) YWQLKYI | 219 93 | 224 99 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab