<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26602

Description Uncharacterized protein
SequenceMSSTGHFPGAPHNTEPVTTMATSSSQPIVSPSSASYTVPQQPPGSQSHQGEPSSVASQPAPSSVNPRSAPTDEPRAASSASNVPPAGDAPAADPGAEPGANPAADPGANPTAGQSGDPATTSTDTTSTTTTDTTATTTTGTATTGTATTTTTTSTGTTATAVMTGRITPPVSMETIFQEVIKRCNNCLFLVRKLRIKQDHITDLYLGNEDTHEFKHAAQLYKDFGVMMQEVMLIYDKLDHIARRLPQVLPPTDNLNVMRLLYTQEHTMCHTDIFGLIEKMIDSGNWNEGNYQIFFFLSELLRVPGGRKDNRYPDLFPLPEPRFHFHAVNGHMAFETAYNNMKKEIVIKSLGIYPKTLFRTSSSLIIEFLFGCGGGKVITDSDVVITIKFLVIERYGIVEYINMVAPNEGWDWVNNYGVPMLNPFTPSCYEVYRRLTRQANIHLLNCFGQHASRWTSTSLLQFVSLFGKFRDVFTARCRVCKKFLKNYLPPLIFDIRTPNNAAHEACR
Length507
PositionTail
OrganismCaenorhabditis remanei (Caenorhabditis vulgaris)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.09
Grand average of hydropathy-0.302
Instability index45.13
Isoelectric point6.57
Molecular weight55671.32
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP26602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.67|      17|      18|     125|     141|       1
---------------------------------------------------------------------------
  125-  141 (30.82/14.11)	TTSTTTTDTTATTTTGT
  144-  160 (28.85/12.77)	TGTATTTTTTSTGTTAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     111.86|      19|      19|      85|     103|       2
---------------------------------------------------------------------------
   43-   59 (26.30/11.51)	PGSQSHQGEPSSV..ASQP
   61-   79 (29.01/13.40)	PSSVNPRSAPTDEPRAASS
   85-  103 (32.80/16.05)	PAGDAPAADPGAEPGANPA
  106-  119 (23.75/ 9.72)	P.G....ANPTAGQSGDPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.26|      16|      18|     284|     299|       3
---------------------------------------------------------------------------
  284-  299 (31.28/20.10)	GNWNEGNYQIFFFLSE
  305-  320 (30.98/19.84)	GGRKDNRYPDLFPLPE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26602 with Med27 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MSSTGHFPGAPHNTEPVTTMATSSSQPIVSPSSASYTVPQQPPGSQSHQGEPSSVASQPAPSSVNPRSAPTDEPRAASSASNVPPAGDAPAADPGAEPGANPAADPGANPTAGQSGDPATTSTDTTSTTTTDTTATTTTGTATTGTATTTTTTSTGTTATAVMTGRITP
1
169

Molecular Recognition Features

MoRF SequenceStartStop
NANANA