<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26594

Description CRE-MDT-29 protein
SequenceMSELFYFDNTCDQKKDIFLQVYRTIKQNMSGQGQQPNLTAQQQQMILQQQQQHMMRQQHMQQQQMHQRQMQQQVQPTGQFQRARTPQMQQHAPGGSPGGSHLQMHPHLQPPGHMQPRSPLVGSQLNAPGSVPAGNPATPQMMHQQMGMNQPMSLPAPHISRPASVAPPASVPPNLQTTGGGPPSNQMDSMGGQPQYPLHLQPQQTPSRPGSQQGQHVNNSHGGPQSVQQPTSIQRPGSVLAPGSIQQPESLGAPPSNSVIGGPQSVQGYGPGSVQPPGSAQAPSSAQPGSAFAPGSIQAPASQQPPSSIQPPPSAASSSAVGGATAAQNSKEPLKPNEEQIRMVQDPVDLVRNLVQKDLRNSVVEMNKRGADLVRQREEKNVNESDRAQFKRAANDFHAVCDEIDRTLTTVMETAKQLIKLEKVFMDRNSKELDGELMVNSVQSFVDNTDIVQKMFDETIGGVTASMEKMRRRQKKWEDLQKETQNNEDVEMIE
Length494
PositionTail
OrganismCaenorhabditis remanei (Caenorhabditis vulgaris)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.03
Grand average of hydropathy-0.871
Instability index72.07
Isoelectric point7.27
Molecular weight53987.88
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
lateral inhibition	GO:0046331	IEA:EnsemblMetazoa
positive regulation of Notch signaling pathway	GO:0045747	IEA:EnsemblMetazoa
regulation of cell fate specification	GO:0042659	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP26594
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     215.54|      25|      26|     271|     295|       1
---------------------------------------------------------------------------
  106-  129 (37.43/ 9.89)	P.HLQPPGHMQ.PRSPLVGSQL.nAPG
  162-  184 (34.90/ 8.74)	PASVAPP..ASVPPNLQTTGGG..PPS
  197-  213 (30.35/ 6.67)	PLHLQPQ...QTPS..RPGS.....QQ
  218-  237 (31.43/ 7.16)	NNSHGGPQSVQQPTSIQ.......RPG
  242-  264 (29.70/ 6.37)	PGSIQQPESLGAP....PSNSVigGPQ
  271-  295 (51.73/16.41)	PGSVQPPGSAQAPSSAQPGSAF..APG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.25|      21|      22|      41|      61|       2
---------------------------------------------------------------------------
   13-   36 (28.12/ 8.40)	QKK....DIFLQvyrTIKQNMSGQGQQP
   41-   61 (41.35/15.48)	QQQ....QMILQ...QQQQHMMRQQHMQ
   62-   84 (28.78/ 8.76)	QQQmhqrQM..Q...QQVQPTGQFQRAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.29|      20|      20|     343|     362|       4
---------------------------------------------------------------------------
  343-  362 (33.88/26.42)	MVQDPVDLVRNLVQKDLRNS
  366-  385 (32.40/24.94)	MNKRGADLVRQREEKNVNES
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26594 with Med29 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EMNKRGADLVRQREEKNVNESDRAQFKRAA
2) YRTIKQNMSGQGQQPNLTAQQQQMILQQQQQHMMRQQHMQQQQMHQRQMQQQVQPTGQFQRARTPQMQQHAPGGSPGGSHLQMHPHLQPPGHMQPRSPLVGSQLNAPGSVPAGNPATPQMMHQQMGMNQPMSLPAPHISRPASVAPPASVPPNLQTTGGGPPSNQMDSMGGQPQYPLHLQPQQTPSRPGSQQGQHVNNSHGGPQSVQQPTSIQRPGSVLAPGSIQQPESLGAPPSNSVIGGPQSVQGYGPGSVQPPGSAQAPSSAQPGSAFAPGSIQAPASQQPPSSIQPPPSAASSSAVGGATAAQNSKEPLKPNEEQIRMVQDPVDLVR
365
22
394
352










Molecular Recognition Features






MoRF SequenceStartStop




NANANA