Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MQMETTESEKTRFEVECEFVQALGNPNYLNFLAQRGYFKEEYFVNYLKYLLYWKKPEYARCLKFPQCLHMLEALQSQQFRDAMAYGNDFYQITFCSTFLSGPSAKFVEDQVVLQWQFYLRKRHRLCMMPEEEGQELVDSEEEVEQPSEEKDTEEDTDEEEEAKNTKVTEGTEEKEATEETQPDAEMADAAESTS |
Length | 194 |
Position | Middle |
Organism | Caenorhabditis remanei (Caenorhabditis vulgaris) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.883 |
Instability index | 65.90 |
Isoelectric point | 4.33 |
Molecular weight | 22908.06 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26593 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.99| 16| 16| 129| 144| 1 --------------------------------------------------------------------------- 129- 144 (27.10/14.23) PEEE..GQELVDSEEEVE 146- 163 (21.89/10.11) PSEEkdTEEDTDEEEEAK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.64| 24| 27| 67| 90| 3 --------------------------------------------------------------------------- 67- 90 (43.43/28.31) CLHMLEALQSQQFRDAMAYGNDFY 95- 118 (43.21/28.14) CSTFLSGPSAKFVEDQVVLQWQFY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEAKNTKVTEGTEEKEATEETQPDAEMADAAEST 2) EQPSEEKD | 160 144 | 193 151 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab