<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26584
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MSTQVSISGLVQVELYQSLLNRLANHTHSFSHFNSREIGFDRGPLETISEDSNLLTLKHTIRTPGIIENDSPINYKNPIRNGWSLISLGRIEPERLSPEFSIRPIHFCPIIAGNPIEFVSALGYRRTFEYFRRGVQFVRGGVIIEIFRVYHSEDDEKPMAGADLHLITVTAIIPSAVRVSNPTNPTGTAAGTTGTTTTGTTGTTTTTTNTTNPTAAAATTTTTTTTTSSSSANSGPTVQELRNEACARVREIQAILKGLADLGRVEPF |
| Length | 268 |
| Position | Head |
| Organism | Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) (Black stem rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.228 |
| Instability index | 35.85 |
| Isoelectric point | 6.66 |
| Molecular weight | 29089.29 |
| Publications | PubMed=21536894
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26584
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.27| 15| 15| 192| 206| 1
---------------------------------------------------------------------------
192- 206 (26.21/10.08) TTGTTTTGTTGTTTT
210- 222 (22.18/ 7.56) TTNPTAAAAT..TTT
223- 237 (23.88/ 8.62) TTTTTSSSSANSGPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.30| 15| 17| 48| 62| 2
---------------------------------------------------------------------------
48- 62 (24.37/14.11) ISEDSNLLTLKHTIR
66- 80 (26.93/16.19) IIENDSPINYKNPIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.46| 19| 29| 95| 116| 4
---------------------------------------------------------------------------
95- 116 (29.96/28.27) RLSPEFSIRPIHFcpiIAGNPI
125- 143 (34.50/21.65) RRTFEYFRRGVQF...VRGGVI
---------------------------------------------------------------------------
|