<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26583
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MSTQVSISGLVQVELYQSLLNRLANHTHSFSHFNSREIGFDRGPLETISEDSNLLTLKHTIRTPGIIENDSPINYKNPIRNGWSLISLGRIEPERLSPEFSIRPIHFCPIIAGNPIEFVSALGYRRTFEYFKRGVQFVRGGVIIEIFRVYHSEDDEKPMAGADLHLITVTAIIPSAVRVSNPTNPTGTAAGTTGTTTTGTTGTTTTTTNTTNPTAAAATTTTTTTTTTSSSSANSGPTVQELRNEACARVREIQAILKGLADLGRVEPF |
Length | 269 |
Position | Head |
Organism | Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) (Black stem rust fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.228 |
Instability index | 34.28 |
Isoelectric point | 6.66 |
Molecular weight | 29162.38 |
Publications | PubMed=21536894
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26583
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.41| 13| 15| 196| 210| 1
---------------------------------------------------------------------------
196- 210 (18.44/10.26) TTTGTTGTTTTTtnT
214- 226 (20.97/ 6.80) TAAAATTTTTTT..T
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.25| 19| 29| 95| 116| 3
---------------------------------------------------------------------------
95- 116 (30.13/26.82) RLSPEFSIRPIHFcpiIAGNPI
125- 143 (33.12/19.04) RRTFEYFKRGVQF...VRGGVI
---------------------------------------------------------------------------
|