Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAGNTINATTASEDLQKDKEANQVRFEEDLEFVQSLANPHFVQELTLNGTLRSETMINTWIPQYFHHPDYARSSLPTLEILDLLTARAVPNDDETRACPTSGRNIHPELDLTQRSLE |
Length | 117 |
Position | Middle |
Organism | Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) (Black stem rust fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.609 |
Instability index | 54.80 |
Isoelectric point | 4.67 |
Molecular weight | 13265.52 |
Publications | PubMed=21536894 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP26582 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KEANQVRFEEDLEFVQSLANPHFV 2) LRSETMINTWIPQYFHHPDYARSSLPTLEILDLLTARAVPNDDETRACPTSGRNIHPELD | 19 51 | 42 110 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab