<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26562
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MASAGVAAGRQAEDALPPPAEPSLPETKPLPPSQPPPPVAVPQPQQSPATRPQSPAGVKEEENYSFLPLVHNIIKCMDKDSPDIHQDLNALKTKFQEMRKVISSMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCMFEIPKE |
| Length | 147 |
| Position | Middle |
| Organism | Canis lupus familiaris (Dog) (Canis familiaris) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Canidae> Canis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.733 |
| Instability index | 103.71 |
| Isoelectric point | 6.31 |
| Molecular weight | 16321.52 |
| Publications | PubMed=16341006
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26562
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.15| 13| 16| 17| 31| 1
---------------------------------------------------------------------------
17- 31 (22.97/10.43) PPPaeP.SLPETKPLP
35- 48 (24.18/ 6.89) PPP..PvAVPQPQQSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.01| 19| 22| 79| 100| 2
---------------------------------------------------------------------------
82- 100 (32.88/24.52) PDIHQDLNALKTKFQEMRK
106- 124 (33.12/16.19) PGIHLSPEQQQQQLQSLRE
---------------------------------------------------------------------------
|