<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26553
Description |
Uncharacterized protein (Fragment) |
Sequence | MVRGKSELVGTGSNTDIVTLSLILNHIVTFRGCESGAGDGDYPAALILGTFRWTSWTPVVFYTQLVLSAFSCLAQCSSVNAGLVWKAFIIGRLPRLLASFQKLVNHGEQCRYGL |
Length | 114 |
Position | Tail |
Organism | Moniliophthora perniciosa (strain FA553 / isolate CP02) (Witches'-broom disease fungus) (Marasmius perniciosus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.396 |
Instability index | 25.22 |
Isoelectric point | 8.84 |
Molecular weight | 12382.22 |
Publications | PubMed=19019209
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26553
No repeats found
|