<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26551
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDSLSIASIPYPELLAYAQSLSAFTSAPPNMPDQNIPGRPPPPLLFPPFPNEEKMRRGHLNAEAPLGLLGETHSVGKAPTVSPKGPDAHQHGANPYRHDLRAPQPDLFNLELDLDLNPDL |
| Length | 120 |
| Position | Middle |
| Organism | Moniliophthora perniciosa (strain FA553 / isolate CP02) (Witches'-broom disease fungus) (Marasmius perniciosus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.528 |
| Instability index | 56.86 |
| Isoelectric point | 5.14 |
| Molecular weight | 13029.56 |
| Publications | PubMed=19019209
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.50| 25| 52| 14| 38| 2
---------------------------------------------------------------------------
14- 38 (44.48/22.50) LLAYAQSLSAFTSAPPNMPDQNIPG
68- 92 (45.02/22.85) LLGETHSVGKAPTVSPKGPDAHQHG
---------------------------------------------------------------------------
|