<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26546
| Description |
Uncharacterized protein |
| Sequence | MHDDWPPTAQTDIMRIYRAKRDQTRRTVQSKYTILGFISSGTYGRVYKAQSQDGSGTIHAIKKFKPDKEGDVVTYTGISQSAIREIALNREINHENVVALKEVILEDKSIYMVFDYAEHDFLQVIHHHSQTLRYPIPSAILKSLIYQLLNGLIYLHSCHILHRDLKPANILITSSGVVKIGDLGLARLIYEPLQPLFAGDKVVVTIWYRAPELLLGAKHYGKPIDCWAVGCVLAELASLRPIFKGEEAKMDGKKNVPFQKDQLLKIFEVLGTPDTGIWPGLADMPEYTNMMRLDR |
| Length | 295 |
| Position | Kinase |
| Organism | Moniliophthora perniciosa (strain FA553 / isolate CP02) (Witches'-broom disease fungus) (Marasmius perniciosus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Marasmiaceae> Moniliophthora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.172 |
| Instability index | 36.77 |
| Isoelectric point | 8.57 |
| Molecular weight | 33444.38 |
| Publications | PubMed=19019209
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP26546
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.55| 12| 41| 141| 152| 1
---------------------------------------------------------------------------
141- 152 (20.58/13.12) LKSLIYQLLNGL
185- 196 (21.96/14.43) LARLIYEPLQPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.40| 18| 29| 15| 32| 2
---------------------------------------------------------------------------
15- 32 (30.97/22.80) RIYRAKRDQTRRTVQS..KY
45- 64 (26.44/18.53) RVYKAQSQDGSGTIHAikKF
---------------------------------------------------------------------------
|