<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26543

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMPGMQNKMPGMGMMPTQSGGPMSHMGPIQTMQNNSMLTQMNQMGQGNIPQQMNQMVPGQMGQLATGQMQQNMQSQMQNQLPSQMSSQIGGPIGGIQTNMPQQMNQIGPGQLGPGQMQQQLNHMQRKPSEMMNTGFSGPRNVTPNQFLRQSPSPSVPSPAGLGAPSNNQMVASPALVPSPSPQHGIMSGPSRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRKMIARMGSEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKLDFKRGDGSVGPPVTTLKEHQIFSPLLEAVSAHLQSPMINHTLQRTFGPYLNALFGPEIKNLPPPLKKQKVEEPPSEIPDVLQGEIARLDQRFKVSLDPAQQNGSKCIQLICWLDDRHLPCVPPVSVTVPADYPLTPPRCVMAPHEYEATPFLCAVQKALNARIAKLPRRFSLSQLLDTWEMSVRQASAPTQVNVTASTVLMGL
Length490
PositionTail
OrganismHarpegnathos saltator (Jerdon's jumping ant)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Ponerinae> Ponerini> Harpegnathos.
Aromaticity0.03
Grand average of hydropathy-0.454
Instability index60.79
Isoelectric point9.42
Molecular weight53290.13
Publications
PubMed=20798317

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP26543
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.59|      22|      22|      39|      60|       1
---------------------------------------------------------------------------
   39-   60 (46.42/17.79)	QMNQMGQGNIPQQMNQM..VPGQM
   67-   84 (30.85/ 9.32)	QMQQ....NMQSQMQNQ..LPSQM
  107-  130 (33.33/10.67)	GPGQLGPGQMQQQLNHMqrKPSEM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.60|      22|      22|     144|     165|       2
---------------------------------------------------------------------------
  144-  165 (43.99/16.94)	NQFLRQSPS..PSVPSPA.G.LGA.PS
  167-  190 (26.88/ 7.75)	NQMV.ASPAlvPS.PSPQhGiMSG.PS
  195-  217 (35.73/12.50)	SVGMAPSPS..SSLNTPG.G.VGAtPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.61|      21|      23|     257|     279|       3
---------------------------------------------------------------------------
  231-  255 (30.18/15.38)	QLSKYIEPLRKMIARMGsegnVDKL
  257-  277 (35.43/27.42)	KMKKLLEILSNPSKRMP....LDTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.60|      14|      23|     372|     385|       7
---------------------------------------------------------------------------
  372-  385 (25.81/13.79)	IARLDQRFKVSLDP
  397-  410 (28.79/16.13)	ICWLDDRHLPCVPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP26543 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MPGMQNKMPGMGMMPTQSGGPMSHMGPIQTMQNNSMLTQMNQMGQGNIPQQMNQMVPGQMGQLATGQMQQNMQSQMQNQLPSQMSSQIGGPIGGIQTNMPQQMNQIGPGQLGPGQMQQQLNHMQRKPSEMMNTGFSGPRNVTPNQFLRQSPSPSVPSPAGLGAPSNNQMVASPALVPSPSPQHGIMSGPSRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQ
1
231










Molecular Recognition Features






MoRF SequenceStartStop




NANANA