<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26543
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MPGMQNKMPGMGMMPTQSGGPMSHMGPIQTMQNNSMLTQMNQMGQGNIPQQMNQMVPGQMGQLATGQMQQNMQSQMQNQLPSQMSSQIGGPIGGIQTNMPQQMNQIGPGQLGPGQMQQQLNHMQRKPSEMMNTGFSGPRNVTPNQFLRQSPSPSVPSPAGLGAPSNNQMVASPALVPSPSPQHGIMSGPSRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRKMIARMGSEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKLDFKRGDGSVGPPVTTLKEHQIFSPLLEAVSAHLQSPMINHTLQRTFGPYLNALFGPEIKNLPPPLKKQKVEEPPSEIPDVLQGEIARLDQRFKVSLDPAQQNGSKCIQLICWLDDRHLPCVPPVSVTVPADYPLTPPRCVMAPHEYEATPFLCAVQKALNARIAKLPRRFSLSQLLDTWEMSVRQASAPTQVNVTASTVLMGL |
| Length | 490 |
| Position | Tail |
| Organism | Harpegnathos saltator (Jerdon's jumping ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Ponerinae> Ponerini> Harpegnathos.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.454 |
| Instability index | 60.79 |
| Isoelectric point | 9.42 |
| Molecular weight | 53290.13 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26543
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 110.59| 22| 22| 39| 60| 1
---------------------------------------------------------------------------
39- 60 (46.42/17.79) QMNQMGQGNIPQQMNQM..VPGQM
67- 84 (30.85/ 9.32) QMQQ....NMQSQMQNQ..LPSQM
107- 130 (33.33/10.67) GPGQLGPGQMQQQLNHMqrKPSEM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 106.60| 22| 22| 144| 165| 2
---------------------------------------------------------------------------
144- 165 (43.99/16.94) NQFLRQSPS..PSVPSPA.G.LGA.PS
167- 190 (26.88/ 7.75) NQMV.ASPAlvPS.PSPQhGiMSG.PS
195- 217 (35.73/12.50) SVGMAPSPS..SSLNTPG.G.VGAtPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.61| 21| 23| 257| 279| 3
---------------------------------------------------------------------------
231- 255 (30.18/15.38) QLSKYIEPLRKMIARMGsegnVDKL
257- 277 (35.43/27.42) KMKKLLEILSNPSKRMP....LDTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.60| 14| 23| 372| 385| 7
---------------------------------------------------------------------------
372- 385 (25.81/13.79) IARLDQRFKVSLDP
397- 410 (28.79/16.13) ICWLDDRHLPCVPP
---------------------------------------------------------------------------
|