<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26533

Description Mediator of RNA polymerase II transcription subunit 30
SequenceMAGQQHPFLSGFPNVQQTALRTQFGGGQMVSGLMGSQQGNIVNPQQFGMGVGVGVGVGNVGSNTMGMPSSQQVLAQQQQQQQSIAMQQQMQQMQQQQLQLQQQQQAAMVQQNSQASNQATTPQTPVPPTQPPPQPQQNKEFNTASLCRFGQETVQEIVSRTLELFQTLKLVQPPNGTTQGANMANEKKTKVYEQLRMLKMLFKRLRLIYEKCNENCQLQGMEYTHIESLIPLKEDLEIMKSDEKKPSEAYRLVCEESKEVVEQVILKNRHLKEIIDHLRRIISEINTMLSMRRS
Length294
PositionHead
OrganismHarpegnathos saltator (Jerdon's jumping ant)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Ponerinae> Ponerini> Harpegnathos.
Aromaticity0.04
Grand average of hydropathy-0.641
Instability index61.19
Isoelectric point8.87
Molecular weight33168.61
Publications
PubMed=20798317

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP26533
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.04|      23|      32|      14|      45|       1
---------------------------------------------------------------------------
   16-   44 (38.25/28.31)	QQtalrtqFGGGQMV........SGLMG..SQQGNIVNP
   45-   77 (30.79/11.44)	QQ......FGMGVGVgvgvgnvgSNTMGmpSSQQVLAQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.57|      25|      32|      80|     105|       2
---------------------------------------------------------------------------
   78-  103 (40.03/14.88)	QQ....QQQSIAMQQ....QmQQMQQQQLQLQQQ
  104-  136 (34.54/ 9.54)	QQaamvQQNSQASNQattpQ.TPVPPTQPPPQPQ
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP26533 with Med30 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) QQQQQAAMVQQNSQASNQATTPQTPVPPTQPPPQPQQNKEFNTAS
101
145

Molecular Recognition Features

MoRF SequenceStartStop
NANANA