<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26530
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MVHFKVETLQCRVGLNPQHLQSLHIKVQPLQEHKDQWSLEELQIIEKFFDTRAATPPYKPNTLSGFGKLLNVPFNVLKDIVQLMKLELVPSLVQQQQLKWSVQWCLRIPPSATPIVPTGMAAMIVCRTKTLFFLQITRIGIQYQGEAPSMVLPLVYDVSSNNTQLAEKRDPSPAFATASMHLKRFSDYASTQPECSLFPTVRDLLANFSLPSEPPILSQVTSSAAGQVTPAQQQIQNTAMQLHSPMASGQGPPQGPYGVQGMLPMGMMNGLPQ |
| Length | 273 |
| Position | Tail |
| Organism | Harpegnathos saltator (Jerdon's jumping ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Ponerinae> Ponerini> Harpegnathos.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.127 |
| Instability index | 51.07 |
| Isoelectric point | 8.67 |
| Molecular weight | 30272.86 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26530
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.46| 10| 18| 245| 254| 2
---------------------------------------------------------------------------
245- 254 (21.49/11.64) PMASGQGPPQ
264- 273 (21.97/12.07) PMGMMNGLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.38| 12| 21| 175| 186| 5
---------------------------------------------------------------------------
175- 186 (21.75/15.54) FATASMHLKRFS
198- 209 (21.63/15.41) FPTVRDLLANFS
---------------------------------------------------------------------------
|