<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26527
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MASPLENLEAQLELFIENVRQIRIIVSDFQPQGQNVLNQKIQGLVSGLQEVDKLKSQVQDVHVPLEVFDYIDQGRNPQLYTKDCIEKALTKNEQVKGKIDAYRKFKANMLVELNRVFPNELAKYRAIRGDE |
Length | 131 |
Position | Middle |
Organism | Harpegnathos saltator (Jerdon's jumping ant) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Ponerinae> Ponerini> Harpegnathos.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.491 |
Instability index | 25.90 |
Isoelectric point | 5.91 |
Molecular weight | 15114.15 |
Publications | PubMed=20798317
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26527
No repeats found
No repeats found
|