<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26485
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNRLDDPPGLMKGRKPSFIGMNGAPETDDQQRLRFQVELEFVQCLANPNYLNFLAQRGYFKDLTFINYLKYLLYWKEPEYAKYLKYPMCLYFLDLLQYEHFRREVVNSQCTKFIDDQQILLWQHYTRRRTRLLQTAAEQTQHINPQNNGIAQPKVP |
| Length | 156 |
| Position | Middle |
| Organism | Camponotus floridanus (Florida carpenter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Formicinae> Camponotus.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.653 |
| Instability index | 43.42 |
| Isoelectric point | 8.94 |
| Molecular weight | 18774.34 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26485
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 70.20| 14| 15| 41| 54| 1
---------------------------------------------------------------------------
41- 54 (25.85/12.79) FVQCLANPNYLNFL
59- 72 (24.43/11.77) YFKDLTFINYLKYL
86- 96 (19.92/ 8.54) YPMCL...YFLDLL
---------------------------------------------------------------------------
|