<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26483
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MATPTNSSGNLVDEFEEAFQQCLSMLIKDEGLVSNGTGASGGLTVDKDEGRAEMEQATMRFIDLARQMEAFFLQKRFLLSALKPEMVVKEDIQELRMELARKEELIKRHNEKIVVWQNMLSDLQGWAQSPAQGPAPNGLPSGNQSGQNQQAGSGGGNASMQQQQQMLQHQQQLQQQLQQQQHPQLQQQLQHPLQQQVQQGSGGPPTSGLQGVGVPVSQQGMFMAQGVAGGRAAGFPVGGMGNSALQGPLAFLEKTTSNIGMPERRS |
| Length | 266 |
| Position | Head |
| Organism | Camponotus floridanus (Florida carpenter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Formicinae> Camponotus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.598 |
| Instability index | 63.31 |
| Isoelectric point | 5.43 |
| Molecular weight | 28833.12 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.27| 14| 15| 162| 175| 1
---------------------------------------------------------------------------
162- 175 (29.05/10.66) QQQQMLQHQQQLQQ
178- 191 (27.23/ 9.56) QQQQHPQLQQQLQH
---------------------------------------------------------------------------
|