<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26480
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MTAPISTAMDSLSAALKSNIIPNQEYLLQGSVLDTSVEVLLHRLRGLCDNVDTGPEPFYDHEMCFSIRRGSPQEQPLLLRVRRALDAIHSDMPWQLRYIGQPELGDKSRPTVVRSSIDIATSNTVVEFLTELGCKLDFEYVTRGYMFRKGRMKITVSKIFKVNQGKVPEGVPEMISQSYLVELSVLAPSGQDAIAEDMRIFAEQLRPLVQLEKIDYKRLVH |
| Length | 221 |
| Position | Head |
| Organism | Camponotus floridanus (Florida carpenter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Formicinae> Camponotus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.177 |
| Instability index | 49.32 |
| Isoelectric point | 6.12 |
| Molecular weight | 24982.59 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.92| 24| 107| 86| 109| 2
---------------------------------------------------------------------------
86- 109 (47.61/30.20) DAIHSDM...PWQLRYIGQPELGDKSR
192- 218 (37.31/22.43) DAIAEDMrifAEQLRPLVQLEKIDYKR
---------------------------------------------------------------------------
|