<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26479
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MGDQFRKVEQYSPKSSPRGARSPVVSRQDSTGTLKTTISLGKNPSIVHSGPFYLMKEPPGESELTGATNLMGYYGLEHSYTKFSGKKPKEQLSSFLPNLPGIIDKPGHHDNSSLRSVIEKPPIGGKELLPLTSVQLAGFRLHPGPLPEQYRYVNQAPQRKHKNKHKKHKHKPGEVLSGQEVATTDVGGSDTHEKKHKKQKRHDEEKEARKKRKKEKKRKKQKHSPEHTGSLTPSQHSNS |
| Length | 239 |
| Position | Head |
| Organism | Camponotus floridanus (Florida carpenter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Formicinae> Camponotus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.244 |
| Instability index | 50.26 |
| Isoelectric point | 10.02 |
| Molecular weight | 26778.02 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26479
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.48| 14| 19| 192| 205| 1
---------------------------------------------------------------------------
161- 174 (26.93/ 9.35) HKNKHKKHKHKPGE
192- 205 (27.70/ 9.78) HEKKHKKQKRHDEE
214- 226 (23.85/ 7.66) KEKKRKKQK.HSPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.62| 25| 34| 88| 121| 2
---------------------------------------------------------------------------
96- 121 (42.03/31.37) LP....NLPGIIDKPGHHDNsSLRSVIEKP
129- 157 (42.59/15.12) LPltsvQLAGFRLHPGPLPE.QYRYVNQAP
---------------------------------------------------------------------------
|