| Description | Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MATQRALPQSKEALLKSYMTRLKDDVKSMLENFEEIIKLAKGENDSQLSRMTQCEQDTYEMQVRASNIVRAGESLMKLVSDIKQYLILNDFPSVNDAIIQNGKLFRTKQVECDQKLASLRDDMAADLYDLEEEYYTSIYK |
| Length | 140 |
| Position | Head |
| Organism | Camponotus floridanus (Florida carpenter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Formicinae> Camponotus. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.558 |
| Instability index | 38.80 |
| Isoelectric point | 4.86 |
| Molecular weight | 16205.30 |
| Publications | PubMed=20798317 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP26477 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) ADLYDLEEEYYTSIYK 2) NFEEIIKLAK | 125 32 | 140 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab