<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26477
| Description |
Mediator of RNA polymerase II transcription subunit 22 |
| Sequence | MATQRALPQSKEALLKSYMTRLKDDVKSMLENFEEIIKLAKGENDSQLSRMTQCEQDTYEMQVRASNIVRAGESLMKLVSDIKQYLILNDFPSVNDAIIQNGKLFRTKQVECDQKLASLRDDMAADLYDLEEEYYTSIYK |
| Length | 140 |
| Position | Head |
| Organism | Camponotus floridanus (Florida carpenter ant) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Formicinae> Camponotus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.558 |
| Instability index | 38.80 |
| Isoelectric point | 4.86 |
| Molecular weight | 16205.30 |
| Publications | PubMed=20798317
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26477
No repeats found
|