Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MATQRALPQSKEALLKSYMTRLKDDVKSMLENFEEIIKLAKGENDSQLSRMTQCEQDTYEMQVRASNIVRAGESLMKLVSDIKQYLILNDFPSVNDAIIQNGKLFRTKQVECDQKLASLRDDMAADLYDLEEEYYTSIYK |
Length | 140 |
Position | Head |
Organism | Camponotus floridanus (Florida carpenter ant) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Formicinae> Camponotus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.558 |
Instability index | 38.80 |
Isoelectric point | 4.86 |
Molecular weight | 16205.30 |
Publications | PubMed=20798317 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26477 No repeats found |
MoRF Sequence | Start | Stop |
1) ADLYDLEEEYYTSIYK 2) NFEEIIKLAK | 125 32 | 140 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab