Description | Uncharacterized protein |
Sequence | MTAPPVDLVSSLQEAIGRLNAMLFNYLGALQRDAPPQPVKGEALVAAPKTYDVLAQTELMASDLMAGLKDVEGLIQQLPELSGSEAEEVAQAVALLQQNAEASQELQQELVAASAKLAQLQDAHGVLAEAALRHRPPAGGTAEQQKTKS |
Length | 149 |
Position | Middle |
Organism | Chlorella variabilis (Green alga) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae> Chlorellales> Chlorellaceae> Chlorella clade> Chlorella. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.119 |
Instability index | 58.48 |
Isoelectric point | 4.57 |
Molecular weight | 15661.59 |
Publications | PubMed=20852019 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP26471 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 132.32| 45| 64| 8| 56| 1 --------------------------------------------------------------------------- 8- 56 (66.19/46.98) LVSSLQEAIGRLNAMLFNYLGALQRDAP.PQPVKGEaLVAAPKTydvLAQ 74- 119 (66.13/35.86) LIQQLPELSGSEAEEVAQAVALLQQNAEaSQELQQE.LVAASAK...LAQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IQQLP 2) VLAEAALRHRP | 75 126 | 79 136 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab