<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26469
| Description |
Uncharacterized protein |
| Sequence | MASQNTALKELLLGSGSGQLNLSAVRARAEELKRSLDQIIQGLQFAADRVQWPDVLDRFAVINVQYQHLLDALRPLLRQFAAYPRSVNQTNAPILPIMLATKLLPEMEGEEAELLQELEAERRRRGGEGQAAAAAQLSMAEQFAWVQDQEQQLNHLIDQLAREEGSPLGERRRKEVQAAAAKAAAATAAPATRPPAPAARQPQQGGPPRGPGAPDPLLAAVTFGTGLS |
| Length | 228 |
| Position | Head |
| Organism | Chlorella variabilis (Green alga) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae>
Chlorellales> Chlorellaceae> Chlorella clade> Chlorella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.358 |
| Instability index | 54.78 |
| Isoelectric point | 5.82 |
| Molecular weight | 24600.61 |
| Publications | PubMed=20852019
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26469
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.41| 12| 46| 121| 134| 1
---------------------------------------------------------------------------
121- 134 (18.19/19.24) ERRRRggEGQAAAA
170- 181 (22.22/14.08) ERRRK..EVQAAAA
---------------------------------------------------------------------------
|