<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26468
Description |
Uncharacterized protein |
Sequence | MGVHLLLYWTAADGAARREAYDALSDAILCLGSSSSSRWTAQAAALRRVQAAAADDLPSVRAAGSEVSLHRVSLSDEPDQLFLLSRAARQVLQAGADMQAFLDRLALFKARGSVQLEGVQHAVGDFRISLARAVQAPQQNFLGLAVDLCYQPLDDAALAGPMLQDLAEVLQEAAEAAGGKLRRVAEGTSAFQLPPVFGPRHRAAQHVQLMAQLQEQAG |
Length | 218 |
Position | Head |
Organism | Chlorella variabilis (Green alga) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Trebouxiophyceae>
Chlorellales> Chlorellaceae> Chlorella clade> Chlorella.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.030 |
Instability index | 42.28 |
Isoelectric point | 5.71 |
Molecular weight | 23208.05 |
Publications | PubMed=20852019
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26468
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.30| 22| 22| 36| 57| 2
---------------------------------------------------------------------------
9- 27 (25.33/10.88) ...WTAADGAARREA.YDALSDA
36- 57 (36.29/18.48) SSRWTAQAAALRRVQ.AAAADDL
59- 81 (28.67/13.19) SVRAAGSEVSLHRVSlSDEPDQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.00| 15| 15| 154| 168| 3
---------------------------------------------------------------------------
154- 168 (26.41/14.46) DDAA.LAGPMLQDLAE
171- 186 (20.59/ 9.79) QEAAeAAGGKLRRVAE
---------------------------------------------------------------------------
|