Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSRMPLIPENPLGLSWHDSAWVPILNPSNVMDYFSERTNPFFDRACNNELVKMQRLNPEQLNNMTGLEYILLHVQEPILYVIRKQHRHSPTQATPLADYYIVAGIVYQAPDLASVINSRLLSTVHHLQSALEESSSYSRYHPSKGYTWDFKDKKFSEKKEKKELTKTEPSSLFQRQRVDMLLNELTRKYPPPRPPGIVQAQQPEQEIKQEPKTEIKTEPNTSSKNMKPPPEKKPRTN |
Length | 237 |
Position | Head |
Organism | Pediculus humanus subsp. corporis (Body louse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Psocodea> Phthiraptera> Anoplura> Pediculidae> Pediculus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.853 |
Instability index | 54.11 |
Isoelectric point | 9.13 |
Molecular weight | 27537.08 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26454 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 43.05| 12| 48| 158| 169| 1 --------------------------------------------------------------------------- 158- 169 (20.89/13.09) KKEKKELTKTEP 208- 219 (22.16/14.27) KQEPKTEIKTEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IVQAQQPEQEIKQEPKTEIK 2) MLLNELTRKYP | 197 180 | 216 190 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab