<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26450
| Description |
"Surfeit locus protein, putative" |
| Sequence | MATSRNLPQSKEALLKSYQTRLKDDVKCMLENFEEIVKLAKGENETQLLRMTQCEQDTYEMHVRAANIVRAGESLMKLVSDMKQYLILNDFPSVNEAIGQNSKIFRQKQEECDQKLMNLRDDMASDLYDLEEEYYTSIYK |
| Length | 140 |
| Position | Head |
| Organism | Pediculus humanus subsp. corporis (Body louse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Psocodea> Phthiraptera> Anoplura> Pediculidae>
Pediculus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.703 |
| Instability index | 51.17 |
| Isoelectric point | 4.91 |
| Molecular weight | 16419.53 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP26450
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.28| 12| 38| 75| 86| 2
---------------------------------------------------------------------------
75- 86 (21.60/13.72) LMKLVSDMKQYL
116- 127 (21.68/13.79) LMNLRDDMASDL
---------------------------------------------------------------------------
|