<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26448
Description |
Cyclin C |
Sequence | MAGNFWQSSHYQQWILDKQDLIRERHHDLQILTEEEYQKIFIFFSNFIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTCVFLASKVEEFGVISNTRLITICQNVVKNKFSYAYAQEFPYRTNHILECEFYLLENLDCCLILYQPYRPLLSLIADIGNGHEDQMMALAWRVVNDSLRTDVCLLYPPYQIALGCLQIACVILQKDLKTWFAELNVDMEKIQEIARHLINLFELWKSYDEKKEIPNLLAKMPKPKNQPSR |
Length | 268 |
Position | Kinase |
Organism | Pediculus humanus subsp. corporis (Body louse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Psocodea> Phthiraptera> Anoplura> Pediculidae>
Pediculus.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.097 |
Instability index | 51.86 |
Isoelectric point | 6.60 |
Molecular weight | 31595.45 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26448
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.64| 10| 39| 147| 157| 1
---------------------------------------------------------------------------
147- 157 (19.57/17.11) DCCLiLYQPYR
189- 198 (23.07/14.74) DVCL.LYPPYQ
---------------------------------------------------------------------------
|