<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26446
Description |
"Transcription elongation factor S-II, putative" |
Sequence | MSTEEEDQALDLLKELQNLPVTLEILTKTRIGMTVNELRKSSSDDEVISLSKTLIKNWKKFLSNSSATSNNKDNNTNNTTATAANTPKLEKSKPVEDKSEEPKPTKKDDRKRHQTSFPPSNTADSVRIKCRELLAAAIKGNTESDQVDGCGSPEDLAEELEEAIFNEFRNTDIKYKNRIRSRVANLKDPKNPNLRMNYLIGALPASRLAVMTAEELASDEMKQIRDKFKKEAINDAQLATVQGTKTDLLKCGKCKKRNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC |
Length | 289 |
Position | Unknown |
Organism | Pediculus humanus subsp. corporis (Body louse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Psocodea> Phthiraptera> Anoplura> Pediculidae>
Pediculus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.857 |
Instability index | 41.42 |
Isoelectric point | 8.51 |
Molecular weight | 32541.43 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26446
No repeats found
|