Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MENLPNGQNNTNLNGCVEEEVDLEFLPLIYEIIKRDPAHDSSQKPRDSQDTSAKILELEKKLIQSRERVNQLPGIEHSQEEQLKQVENLRKQILLKKQLLNKYRNMCNFSMPKLILIILNNLMNNEQLVRKLADSYPMRRAAQLLVYFYHKNKETALEFKNLKQLNGLNLVQKLEKIYKELENKKKKLQ |
Length | 189 |
Position | Middle |
Organism | Pediculus humanus subsp. corporis (Body louse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Paraneoptera> Psocodea> Phthiraptera> Anoplura> Pediculidae> Pediculus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.771 |
Instability index | 46.71 |
Isoelectric point | 9.28 |
Molecular weight | 22341.69 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP26445 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 99.66| 34| 36| 39| 73| 1 --------------------------------------------------------------------------- 39- 73 (51.14/36.69) HDSSQKPRDSQDTSAKILeLEKKLIQS.RERVN.QLP 77- 112 (48.52/30.08) HSQEEQLKQVENLRKQIL.LKKQLLNKyRNMCNfSMP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.35| 18| 39| 119| 136| 2 --------------------------------------------------------------------------- 119- 136 (31.35/17.95) LNNL..MNNEQLVRKLADSY 159- 178 (25.99/13.80) FKNLkqLNGLNLVQKLEKIY --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FLPLIYEI 2) VEEEVDL | 25 17 | 32 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab