<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26441
| Description |
Uncharacterized protein |
| Sequence | MQSDIPQQPQEKLDNISKVKSLILPLRETLSLTLKTAAQALHQNSLIDAGSTKGVDAVVPRFDKNLEEFYSICDQIELHLKTASECLSQGSSSARYLQLPVAPTRTEPIAFQDANVLTYPQYLATVRTQVAYAKEIHDSLTASAQTIAPPE |
| Length | 151 |
| Position | Tail |
| Organism | Pediculus humanus subsp. corporis (Body louse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Psocodea> Phthiraptera> Anoplura> Pediculidae>
Pediculus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.258 |
| Instability index | 58.64 |
| Isoelectric point | 5.35 |
| Molecular weight | 16595.61 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26441
No repeats found
No repeats found
|