Description | Cyclin-dependent kinase 8 |
Sequence | MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLLKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLLTWALPDYLIHL |
Length | 164 |
Position | Kinase |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Mus> Mus. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.381 |
Instability index | 30.03 |
Isoelectric point | 9.10 |
Molecular weight | 19289.18 |
Publications | PubMed=19468303 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule protein kinase activity GO:0004672 IEA:InterPro |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP26424 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 97.36| 30| 49| 72| 105| 1 --------------------------------------------------------------------------- 72- 105 (49.28/40.54) ELKHPNVISLLKVFLS..HADRKVWLLfdyaEHDL..W 122- 155 (48.08/29.24) QLPRGMVKSLLYQILDgiHYLHANWVL....HRDLltW --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DKDYALKQIE 2) DLFEYE 3) FKVKL 4) RGTYGHVYKAKRK | 46 18 5 29 | 55 23 9 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab