<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26424
| Description |
Cyclin-dependent kinase 8 |
| Sequence | MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLLKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLLTWALPDYLIHL |
| Length | 164 |
| Position | Kinase |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.381 |
| Instability index | 30.03 |
| Isoelectric point | 9.10 |
| Molecular weight | 19289.18 |
| Publications | PubMed=19468303
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26424
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.36| 30| 49| 72| 105| 1
---------------------------------------------------------------------------
72- 105 (49.28/40.54) ELKHPNVISLLKVFLS..HADRKVWLLfdyaEHDL..W
122- 155 (48.08/29.24) QLPRGMVKSLLYQILDgiHYLHANWVL....HRDLltW
---------------------------------------------------------------------------
|