Description | Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
Sequence | LAMESGEEVDGGRQRFLLELEFVQCLANPTYIHYLAQNRYFDDEAFVNYLKYLQYWRRPEYAKFIMYPHCLFFLELLQSSHFRAAMVH |
Length | 88 |
Position | Middle |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella. |
Aromaticity | 0.19 |
Grand average of hydropathy | -0.198 |
Instability index | 54.81 |
Isoelectric point | 5.73 |
Molecular weight | 10693.13 |
Publications | PubMed=21551031 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP26386 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) GGRQRFLLELE 2) MESGE | 11 3 | 21 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab