<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26385
Description |
Uncharacterized protein |
Sequence | MEETKLEVMAIEGQKQLEIAVQSAHQILNSLNEVLSNPALWEGGGKEEAGWAAVDDARQKYKAATTALRGIVAAIFNHPQMTSLDVDSTVEKAVDQAEIDRLQKQTVELREEIVRKNDVLKQLITQMRELVRDISMWQTPPPS |
Length | 143 |
Position | Head |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.413 |
Instability index | 41.63 |
Isoelectric point | 4.88 |
Molecular weight | 16021.04 |
Publications | PubMed=21551031
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26385
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.27| 12| 15| 104| 115| 1
---------------------------------------------------------------------------
104- 115 (19.25/13.29) KQTVELREEIVR
121- 132 (20.02/14.06) KQLITQMRELVR
---------------------------------------------------------------------------
|