<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26383
| Description |
Uncharacterized protein |
| Sequence | MDIITQLQDQVNKIAFLAFNSVGSLQRDAAPVRLSQNYPDPQALAPGAPPLPGQQQQQQQQAQQSQQPQQQQEQAPEMASTLVQAAKQFDALVAALPIAEGGEEAQLKRIAELQQAENEEIGKELQLELDLAEEELKLMRELFHTAADDCLRFKQLQ |
| Length | 157 |
| Position | Middle |
| Organism | Selaginella moellendorffii (Spikemoss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.587 |
| Instability index | 72.88 |
| Isoelectric point | 4.36 |
| Molecular weight | 17440.34 |
| Publications | PubMed=21551031
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26383
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.63| 25| 28| 35| 62| 1
---------------------------------------------------------------------------
35- 62 (41.23/22.11) SQnypDPQALAPGAPPLPGQ..QQQQQQQA
65- 91 (39.41/14.37) SQ...QPQQQQEQAPEMASTlvQAAKQFDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.43| 23| 28| 104| 126| 2
---------------------------------------------------------------------------
104- 126 (36.98/17.73) EAQLKRIAEL.QQAENEEIG.KELQ
133- 157 (30.46/13.70) EEELKLMRELfHTAADDCLRfKQLQ
---------------------------------------------------------------------------
|