<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26375
Description |
Uncharacterized protein (Fragment) |
Sequence | MDPILQALQDSYHRLLAACAAALEAKEVAAGERSERTDKALNSFLESHQLFHGACDRAQEFVESVRQRIGSECLVDEATGPVSGRVVAGDAAKAGGGGAAVAPLSAVRLEQLSKAVRWQVIDLQQGGGGGALSNAA |
Length | 136 |
Position | Tail |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.076 |
Instability index | 56.10 |
Isoelectric point | 5.32 |
Molecular weight | 14068.61 |
Publications | PubMed=21551031
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26375
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.02| 20| 35| 5| 39| 1
---------------------------------------------------------------------------
5- 24 (33.00/35.28) LQALQDSYHRLLAACAAALE
41- 60 (36.02/12.28) LNSFLESHQLFHGACDRAQE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.59| 16| 31| 82| 99| 2
---------------------------------------------------------------------------
82- 99 (23.73/16.32) VSGRVVagDAAKAGGGGA
116- 131 (31.86/16.05) VRWQVI..DLQQGGGGGA
---------------------------------------------------------------------------
|