Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAEGLGGAAPPLPTDQTGISFHDQLWLSTYPLDRNLVFDYFVLSPFYDRSCSNEQLRMRSVHPLDMTQLSKMTGVEYVLLEAQEPNLFVLRKQKRESPDKVSHLSAYYILDGHIYQAPLLYSVVCSRVARAVHHISAAFSQVSAKLEKIGYDDENEHESDTSGRVDLKEVLRIDQILGNVLRKLPPAPPPPPMPTPPSGVPEQPQDSQPEQSTEQGPPTKKAKVEKR |
Length | 227 |
Position | Head |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.529 |
Instability index | 66.84 |
Isoelectric point | 5.81 |
Molecular weight | 25429.55 |
Publications | PubMed=21551031 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP26372 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.38| 15| 178| 10| 24| 1 --------------------------------------------------------------------------- 10- 24 (30.08/16.17) PPLPTDQTGISFHDQ 191- 205 (32.29/17.88) PPMPTPPSGVPEQPQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ILGNVLRKLP 2) PTKKAKVEKR | 176 218 | 185 227 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab