<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26371
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGSQSVCLDSRVLHWQPSAGAQVTSQTLVDLFRSIESMNGVRTGRWQITAAQHRPFTRDQAMAIDCAKELLGVAFSEFASKHYFVLRAERMVVEADSSIQAIMEKLQVYRNRLSMVFEGFQYQLGDFQLKAGRAVLSQAENLRGIVLEVEYSPVSSIEKTRQMMQEFVDLWQEAISAQSMSGRISLLEPNFAEYALSDTYTWQHTALQYIFLFAYFLSQSQRA |
Length | 223 |
Position | Head |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.120 |
Instability index | 45.57 |
Isoelectric point | 5.83 |
Molecular weight | 25434.67 |
Publications | PubMed=21551031
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26371
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 139.42| 39| 154| 15| 53| 1
---------------------------------------------------------------------------
15- 53 (69.44/49.65) WQPSAGAQVTSQTLVDLFRSIESMNGVRTGRWQITAAQH
171- 209 (69.98/50.10) WQEAISAQSMSGRISLLEPNFAEYALSDTYTWQHTALQY
---------------------------------------------------------------------------
|