<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26367
| Description |
Mediator of RNA polymerase II transcription subunit 6 (Fragment) |
| Sequence | PLPTDQTGISFHDQLWLSTYPLDRNLVFDYFVLSPFYDRSCSNEQLRMRSVHPLDMTQLSKMTGVEYVLLEAQEPNLFVLRKQKRESPDKVLHLSAYYILDSHIYQAPLLYSVVCSRVARAVHHISAAFSQVSAKLEKIGYDDENEHESDTSGRVDLKEILRIDQILGNVLRKLPPAPPPPPMP |
| Length | 184 |
| Position | Head |
| Organism | Selaginella moellendorffii (Spikemoss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.321 |
| Instability index | 60.05 |
| Isoelectric point | 5.97 |
| Molecular weight | 21075.86 |
| Publications | PubMed=21551031
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP26367
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.81| 24| 44| 31| 55| 1
---------------------------------------------------------------------------
31- 55 (39.22/31.23) FVLSPfYDRSCSNEQLRMRSVHPLD
78- 101 (40.59/26.79) FVLRK.QKRESPDKVLHLSAYYILD
---------------------------------------------------------------------------
|