<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26354
Description |
Uncharacterized protein PFT1B-2 |
Sequence | MLGFWTSSSGSGVTAQQPQAQYLVLAVEAAALGPSWPLLRSEYLDKIARRTMGATLEMALVVFRGHDSYSGCLLQRSGRTPSLELFQLWLSSIDFSGGGFGEVAVAEGLAEALVPPSNQASQRHCILVAASNPHRLQSLIRGADAKPGHWWLADAETVSRAFSQLFVRGSGMLLLILICLSLRLLRSGQAKSSSF |
Length | 195 |
Position | Unknown |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.193 |
Instability index | 47.95 |
Isoelectric point | 8.98 |
Molecular weight | 20974.88 |
Publications | PubMed=21551031
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP26354
No repeats found
|