<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26342
Description |
Uncharacterized protein |
Sequence | MAIEGQKQLEIAVQSAHQILNSLNEVLSNPALWEGGGKEEAGWAAVDDARQKYKAATTALRGIVAAIFNHPQMMSLDVDSTVEKAVDQAEIDRLQKQTVELREEIVRKNDVLKQLITQMRELVRDISMWQTPPPS |
Length | 135 |
Position | Head |
Organism | Selaginella moellendorffii (Spikemoss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.379 |
Instability index | 44.97 |
Isoelectric point | 5.04 |
Molecular weight | 15091.03 |
Publications | PubMed=21551031
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP26342
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.27| 12| 15| 96| 107| 1
---------------------------------------------------------------------------
96- 107 (19.25/14.57) KQTVELREEIVR
113- 124 (20.02/15.41) KQLITQMRELVR
---------------------------------------------------------------------------
|