<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26342
| Description |
Uncharacterized protein |
| Sequence | MAIEGQKQLEIAVQSAHQILNSLNEVLSNPALWEGGGKEEAGWAAVDDARQKYKAATTALRGIVAAIFNHPQMMSLDVDSTVEKAVDQAEIDRLQKQTVELREEIVRKNDVLKQLITQMRELVRDISMWQTPPPS |
| Length | 135 |
| Position | Head |
| Organism | Selaginella moellendorffii (Spikemoss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Lycopodiopsida> Selaginellales> Selaginellaceae> Selaginella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.379 |
| Instability index | 44.97 |
| Isoelectric point | 5.04 |
| Molecular weight | 15091.03 |
| Publications | PubMed=21551031
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26342
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.27| 12| 15| 96| 107| 1
---------------------------------------------------------------------------
96- 107 (19.25/14.57) KQTVELREEIVR
113- 124 (20.02/15.41) KQLITQMRELVR
---------------------------------------------------------------------------
|