<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26336
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MVAPPAPDSPRSSQSPPPDGVQGDLEMELFGLANALYNLGTTVINDSTKERDKPGGGVKQVGLRVNDVIKHLEQLDMMSDHITTRIPFDVLKHVDEAHNPEFITRERIERVAAENQFAYAKIAALDRYRSELNEALAKSFPGIEAELELPMPGDAYVKKEEAPATNGIALNGSSRA |
Length | 176 |
Position | Middle |
Organism | Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Schizophyllaceae> Schizophyllum.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.476 |
Instability index | 51.95 |
Isoelectric point | 4.94 |
Molecular weight | 19220.40 |
Publications | PubMed=20622885
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP26336
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.02| 15| 19| 60| 74| 1
---------------------------------------------------------------------------
60- 74 (24.40/15.42) QVGLRVN.DVIKHLEQ
81- 96 (21.61/13.03) HITTRIPfDVLKHVDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.74| 14| 15| 108| 121| 2
---------------------------------------------------------------------------
108- 121 (23.04/14.40) IERVAAENQFAYAK
125- 138 (22.70/14.12) LDRYRSELNEALAK
---------------------------------------------------------------------------
|