<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26333
| Description |
Uncharacterized protein |
| Sequence | MLDEWSNNLLVHDPMRIYRAKRDASHKTVAAKYHILGFISSGTYGRVYKAQSHGDPGRLHAIKKFKPDKEGDVITYTGISQSAIREIALNREISHENVVSLREVILEDKSIYMVFEYAEHDFLQVIHHHSQTLRTPLPTSLLKSLTYQLLNGLLYLHSAHILHRDLKPANILITSNGVVKIGDLGLARLIHEPLQPLFAGDKVVVTIWYRAPELLLGAKHYHKAIDCWAVGCVLAELASLRPIFKGEEAKLDSKKNVPFQRDQLIKIFEVIGTPTEREWPGVVDMPEYHNMKRLDQMSNRLAEWCTNRIRSPAGVDLIRSLFIYDPDVRLTAHDALRHKWFHEDPKPTKK |
| Length | 350 |
| Position | Kinase |
| Organism | Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Schizophyllaceae> Schizophyllum.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.296 |
| Instability index | 38.53 |
| Isoelectric point | 9.01 |
| Molecular weight | 40116.87 |
| Publications | PubMed=20622885
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP26333
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.97| 22| 27| 156| 181| 1
---------------------------------------------------------------------------
156- 181 (27.50/24.84) LhsAHILHRDLKPanILITSNGVVKI
186- 207 (37.47/19.93) L..ARLIHEPLQP..LFAGDKVVVTI
---------------------------------------------------------------------------
|