<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP26307
| Description |
Uncharacterized protein |
| Sequence | MDGDDWKPHFRLIHAIGLSTKWDMDTLKRHLPISRLEGLHELRKITERFEENIYFSATSQSNYLRKISLKMLTMETKSFNAATSSLPSNFAGHSKKSLNDKKSPARKKALKFR |
| Length | 113 |
| Position | Tail |
| Organism | Vitis vinifera (Grape) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> Vitales> Vitaceae> Viteae> Vitis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.742 |
| Instability index | 41.32 |
| Isoelectric point | 10.10 |
| Molecular weight | 13121.99 |
| Publications | PubMed=17721507
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP26307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.17| 17| 19| 2| 18| 1
---------------------------------------------------------------------------
2- 18 (33.20/22.19) DGDDWKPHFRLIHAIGL
23- 39 (29.97/19.47) DMDTLKRHLPISRLEGL
---------------------------------------------------------------------------
|